5-HTTLPR
──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────
top
5-HTTLPR (serotonin-transporter-linked promoter region) is a degenerate repeat (redundancy in the genetic code) polymorphic region in SLC6A4, the gene that codes for the serotonin transporter. Since the polymorphism was identified in the middle of the 1990s,cite-ref-1[1]cite-ref-2[2] it has been extensively investigated, e.g., in connection with neuropsychiatric disorders. A 2006 scientific article stated that "over 300 behavioral, psychiatric, pharmacogenetic and other medical genetics papers" had analyzed the polymorphism.cite-ref-wendlandj2006simultaneous-3-0[3] While often discussed as an example of gene-environment interaction, this contention is contested.
Contents
• Alleles
• Amygdala
• Insomnia
• Brummett
• Deuschle
──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────
Alleles
The polymorphism occurs in the promoter region of the gene. Researchers commonly report it with two variations in humans: A short ("s") and a long ("l"), but it can be subdivided further.cite-ref-nakamuram2000human-4-0[4] The short (s)- and long (l)- alleles have been thought to be related to stress and psychiatric disorders.cite-ref-0-5-0[5] In connection with the region are two single nucleotide polymorphisms (SNP): rs25531 and rs25532.cite-ref-murphyd2008targeting-6-0[6]
One study published in 2000 found 14 allelic variants (14-A, 14-B, 14-C, 14-D, 15, 16-A, 16-B, 16-C, 16-D, 16-E, 16-F, 19, 20 and 22) in a group of around 200 Japanese and Europeans.cite-ref-nakamuram2000human-4-1[4] The difference between 16-A and 16-D is the rs25531 SNP. It is also the difference between 14-A and 14-D.cite-ref-wendlandj2006simultaneous-3-1[3]
Some studies have found that long allele results in higher serotonin transporter mRNA transcription in human cell lines. The higher level may be due to the A-allele of rs25531, such that subjects with the long-rs25531(A) allelic combination (sometimes written LA) have higher levels while long-rs25531(G) carriers have levels more similar to short-allele carriers. Newer studies examining the effects of genotype may compare the LA/LA genotype against all other genotypes.cite-ref-praschakriedern2007novel-7-0[7] The allele frequency of this polymorphism seems to vary considerably across populations, with a higher frequency of the long allele in Europe and lower frequency in Asia.cite-ref-rspb-2010-0714v1-8-0[8] It is argued that the population variation in the allele frequency is more likely due to neutral evolutionary processes than natural selection.cite-ref-rspb-2010-0714v1-8-1[8]
Neuropsychiatric disorders
In the 1990s it has been speculated that the polymorphism might be related to affective disorders, and an initial study found such a link.cite-ref-9[9] However, another large European study found no such link.cite-ref-10[10] A decade later two studies found that 5-HTT polymorphism influences depressive responses to life stress; an example of gene-environment interaction (GxE) not considered in the previous studies.cite-ref-11[11]cite-ref-12[12]cite-ref-13[13] However, a 2017 meta-analysis found no such association.cite-ref-14[14] Earlier, two 2009 meta-analyses found no overall GxE effect,cite-ref-15[15]cite-ref-16[16] while a 2011 meta-analysis, demonstrated a positive result.cite-ref-17[17] In turn, the 2011 meta-analysis has been criticized as being overly inclusive (e.g. including hip fractures as outcomes), for deeming a study supportive of the GxE interaction which is actually in the opposite direction, and because of substantial evidence of publication bias and data mining in the literature.cite-ref-18[18] This criticism points out that if the original finding were real, and not the result of publication bias, we would expect that those replication studies which are closest in design to the original are the most likely to replicate—instead we find the opposite. This suggests that authors may be data dredging for measures and analytic strategies which yield the results they want.
Treatment response
With the results from one study the polymorphism was thought to be related to treatment response so that long-allele patients respond better to antidepressants.cite-ref-19[19] Another antidepressant treatment response study did, however, rather point to the rs25531 SNP,cite-ref-20[20] and a large study by the group of investigators found a "lack of association between response to an SSRI and variation at the SLC6A4 locus".cite-ref-21[21]
One study could find a treatment response effect for repetitive transcranial magnetic stimulation to drug-resistant depression with long/long homozygotes benefitting more than short-allele carriers. The researchers found a similar effect for the Val66Met polymorphism in the BDNF gene.cite-ref-22[22]
Amygdala
The 5-HTTLPR has been thought to predispose individuals to affective disorders such as anxiety and depression. There have been some studies that test whether this association is due to the effects of variation in 5-HTTLPR on the reactivity of the human amygdala. In order to test this, researchers gathered a group of subjects and administered a harm avoidance (HA) subset of the Tridimensional Personality Questionnaire as an initial mood and personality assessment.cite-ref-1-23-0[23] Subjects also had their DNA isolated and analyzed in order to be genotyped. Next, the amygdala was then engaged by having the subject match fearful facial expressions during an fMRI scan (by the 3-T GE Signa scanner).cite-ref-1-23-1[23] The results of the study showed that there was bilateral activity in the amygdala for every subject when processing the fearful images, as expected. However, the activity in the right amygdala was much higher for subjects with the s-allele, which shows that the 5-HTTLPR has an effect on amygdala activity. There did not seem to be the same effect on the left amygdala.
Insomnia
There has been speculation that the 5-HTTLPR gene is associated with insomnia and sleep quality. Primary insomnia is one of the most common sleep disorders and is defined as having trouble falling or staying asleep, enough to cause distress in one's life. Serotonin (5-HT) has been associated with the regulation of sleep for a very long time now.cite-ref-0-5-1[5] The 5-HT transporter (5-HTT) is the main regulator of serotonin and serotonergic energy and is therefore targeted by many antidepressants.cite-ref-0-5-2[5] There also have been several family and twin studies that suggest that insomnia is heavily genetically influenced. Many of these studies have found that there is a genetic and environment dual-factor that influences insomnia. It has been hypothesized that the short 5-HTTLPR genotype is related to poor sleep quality and, therefore, also primary insomnia. It is important to note that research studies have found that this variation does not cause insomnia, but rather may predispose an individual to experience worse quality of sleep when faced with a stressful life event.
Brummett
The effect that the 5-HTTLPR gene had on sleep quality was tested by Brummett in a study conducted at Duke University Medical Center from 2001 to 2004. The sleep quality of 344 participants was measured using The Pittsburgh Sleep Quality Index. The study found that caregivers with the homozygous s-allele had poorer sleep quality, which shows that the stress of caregiving combined with the allele gave way to worse sleep quality. Although the study found that the 5-HTTLPR genotype did not directly affect sleep quality, the 5-HTTLPR polymorphism's effect on sleep quality was magnified by one's environmental stress.cite-ref-24[24] It supports the notion that the 5-HTTLPR s-allele is what leads to hyperarousal when exposed to stress; hyperarousability is commonly associated with insomnia.
Deuschle
However, in a 2007 study conducted by a sleep laboratory in Germany, it was found that the 5-HTTLPR gene did have a strong association with both insomnia and depression both in participants with and without lifetime affective disorders. This study included 157 insomnia patients and a control group of 836 individuals that had no psychiatric disorders. The subjects were then genotyped through polymerase chain reaction (PCR) techniques.cite-ref-0-5-3[5] The researchers found that the s-allele was greater represented in the vast majority of patients with insomnia compared to those who had no disorder.cite-ref-0-5-4[5] This shows that there is an association between the 5-HTTPLR genotype and primary insomnia. However, it is important to consider the fact that there was a very limited number of subjects with insomnia tested in this study.
Personality traits
5-HTTLPR may be related to personality traits: Two 2004 meta-analyses found 26 research studies investigating the polymorphism in relation to anxiety-related traits.cite-ref-sens2004metaanalysis-25-0[25]cite-ref-26[26] The initial and classic 1996 study found s-allele carriers to on average have slightly higher neuroticism score with the NEO PI-R personality questionnaire,cite-ref-27[27] and this result was replicated by the group with new data.cite-ref-28[28] Some other studies have, however, failed to find this association,cite-ref-29[29] nor with peer-rated neuroticism,cite-ref-30[30] and a 2006 review noted the "erratic success in replication" of the first finding.cite-ref-31[31] A meta-analysis published in 2004 stated that the lack of replicability was "largely due to small sample size and the use of different inventories".cite-ref-sens2004metaanalysis-25-1[25] They found that neuroticism as measured with the NEO-family of personality inventories had quite significant association with 5-HTTLPR while the trait harm avoidance from the Temperament and Character Inventory family did not have any significant association. A similar conclusion was reached in an updated 2008 meta-analysis.cite-ref-32[32] However, based on over 4000 subjects, the largest study that used the NEO PI-R found no association between variants of the serotonin transporter gene (including 5-HTTLPR) and neuroticism, or its facets (Anxiety, Angry-Hostility, Depression, Self-Consciousness, Impulsiveness, and Vulnerability).cite-ref-33[33]
In a study published in 2009, authors found that individuals homozygous for the long allele of 5-HTTLPR paid more attention on average to positive affective pictures while selectively avoiding negative affective pictures presented alongside the positive pictures compared to their heterozygous and short-allele-homozygous peers. This biased attention of positive emotional stimuli suggests they may tend to be more optimistic.cite-ref-34[34] Other research indicates carriers of the short 5-HTTLPR allele have difficulty disengaging attention from emotional stimuli compared to long allele homozygotes.cite-ref-35[35] Another study published in 2009 using an eye tracking assessment of information processing found that short 5-HTTLPR allele carriers displayed an eye gaze bias to view positive scenes and avoid negative scenes, while long allele homozygotes viewed the emotion scenes in a more even-handed fashion.cite-ref-36[36] This research suggests that short 5-HTTLPR allele carriers may be more sensitive to emotional information in the environment than long allele homozygotes.
Neuroimaging
Molecular neuroimaging studies have examined the association between genotype and serotonin transporter binding with positron emission tomography (PET) and SPECT brain scanners. Such studies use a radioligand that binds—preferably selectively—to the serotonin transporter so an image can be formed that quantifies the distribution of the serotonin transporter in the brain. One study could see no difference in serotonin transporter availability between long/long and short/short homozygotes subjects among 96 subjects scanned with SPECT using the iodine-123 β-CIT radioligand.cite-ref-38[38] Using the PET radioligand carbon-11-labeled McN 5652 another research team could neither find any difference in serotonin transporter binding between genotype groups.cite-ref-39[39] Newer studies have used the radioligand carbon-11-labeled DASB with one study finding higher serotonin transporter binding in the putamen of LA homozygotes compared to other genotypes.cite-ref-praschakriedern2007novel-7-1[7] Another study with similar radioligand and genotype comparison found higher binding in the midbrain.cite-ref-40[40]
Associations between the polymorphism and the grey matter in parts of the anterior cingulate brain region have also been reported based on magnetic resonance imaging brain scannings and voxel-based morphometry analysis.cite-ref-41[41] 5-HTTLPR short allele–driven amygdala hyperreactivity was confirmed in a large (by MRI study standards) cohort of healthy subjects with no history of psychiatric illness or treatment.cite-ref-1-23-2[23] Brain blood flow measurements with positron emission tomography brain scanners can show genotype-related changes.cite-ref-42[42] The glucose metabolism in the brain has also been investigated with respect to the polymorphism,cite-ref-43[43] and the functional magnetic resonance imaging (fMRI) brain scans have also been correlated to the polymorphism.cite-ref-44[44]cite-ref-45[45]
Especially the amygdala brain structure has been the focus of the functional neuroimaging studies.
Electrophysiology
The relationship between the Event Related Potentials P3a and P3b and the genetic variants of 5-HTTLPR were investigated using an auditory oddball paradigm and revealed short allele homozygotes mimicked those of COMT met/met homozygotes with an enhancement of the frontal, but not parietal P3a and P3b. This suggests a frontal-cortical dopaminergic and serotoninergic mechanism in bottom-up attentional capture.cite-ref-46[46]
Other organisms
References
cite-note-11. ↑ citerefheilsteufelpetriseemann1995Heils A, Teufel A, Petri S, Seemann M, Bengel D, Balling U, Riederer P, Lesch KP (1995). "Functional promoter and polyadenylation site mapping of the human serotonin (5-HT) transporter gene". Journal of Neural Transmission. General Section. 102 (3): 247–54. doi:10.1007/BF01281159. PMID 8788073. S2CID 8474414.
cite-note-22. ↑ citerefheilsteufelpetrist-ber1996Heils A, Teufel A, Petri S, Stöber G, Riederer P, Bengel D, Lesch KP (June 1996). "Allelic variation of human serotonin transporter gene expression". Journal of Neurochemistry. 66 (6): 2621–4. doi:10.1046/j.1471-4159.1996.66062621.x. PMID 8632190. S2CID 42037860.
cite-note-wendlandj2006simultaneous-33. ↑ citerefwendlandmartinkruselesch2006Wendland JR, Martin BJ, Kruse MR, Lesch KP, Murphy DL (March 2006). "Simultaneous genotyping of four functional loci of human SLC6A4, with a reappraisal of 5-HTTLPR and rs25531". Molecular Psychiatry. 11 (3): 224–6. doi:10.1038/sj.mp.4001789. PMID 16402131. S2CID 26655014.
cite-note-nakamuram2000human-44. ↑ citerefnakamurauenosanotanabe2000Nakamura M, Ueno S, Sano A, Tanabe H (January 2000). "The human serotonin transporter gene linked polymorphism (5-HTTLPR) shows ten novel allelic variants". Molecular Psychiatry. 5 (1): 32–8. doi:10.1038/sj.mp.4000698. PMID 10673766. S2CID 12459610.
cite-note-praschakriedern2007novel-77. ↑ citerefpraschak-riederkennedywilsonhussey2007Praschak-Rieder N, Kennedy J, Wilson AA, Hussey D, Boovariwala A, Willeit M, Ginovart N, Tharmalingam S, Masellis M, Houle S, Meyer JH (August 2007). "Novel 5-HTTLPR allele associates with higher serotonin transporter binding in putamen: a [(11)C] DASB positron emission tomography study". Biological Psychiatry. 62 (4): 327–31. doi:10.1016/j.biopsych.2006.09.022. PMID 17210141. S2CID 46096787.
cite-note-rspb-2010-0714v1-88. ↑ citerefeisenberghayes2011Eisenberg DT, Hayes MG (February 2011). "Testing the null hypothesis: comments on 'Culture-gene coevolution of individualism-collectivism and the serotonin transporter gene'". Proceedings: Biological Sciences. 278 (1704): 329–32. doi:10.1098/rspb.2010.0714. PMC 3013402. PMID 20861042.
cite-note-99. ↑ citerefcollierst-berliheils1996Collier DA, Stöber G, Li T, Heils A, Catalano M, Di Bella D, Arranz MJ, Murray RM, Vallada HP, Bengel D, Müller CR, Roberts GW, Smeraldi E, Kirov G, Sham P, Lesch KP (December 1996). "A novel functional polymorphism within the promoter of the serotonin transporter gene: possible role in susceptibility to affective disorders". Molecular Psychiatry. 1 (6): 453–60. PMID 9154246. Comment: citerefcraddockowen1996Craddock N, Owen MJ (December 1996). "Candidate gene association studies in psychiatric genetics: a SERTain future?". Molecular Psychiatry. 1 (6): 434–6. PMID 9154242.
cite-note-1010. ↑ citerefmendlewiczmassatsouerydel-favero2004Mendlewicz J, Massat I, Souery D, Del-Favero J, Oruc L, Nöthen MM, Blackwood D, Muir W, Battersby S, Lerer B, Segman RH, Kaneva R, Serretti A, Lilli R, Lorenzi C, Jakovljevic M, Ivezic S, Rietschel M, Milanova V, Van Broeckhoven C (May 2004). "Serotonin transporter 5HTTLPR polymorphism and affective disorders: no evidence of association in a large European multicenter study". European Journal of Human Genetics. 12 (5): 377–82. doi:10.1038/sj.ejhg.5201149. PMID 14735161.
cite-note-1111. ↑ citerefcaspisugdenmoffitttaylor2003Caspi A, Sugden K, Moffitt TE, Taylor A, Craig IW, Harrington H, McClay J, Mill J, Martin J, Braithwaite A, Poulton R (July 2003). "Influence of life stress on depression: moderation by a polymorphism in the 5-HTT gene". Science. 301 (5631): 386–9. Bibcode:2003Sci...301..386C. doi:10.1126/science.1083968. PMID 12869766. S2CID 146500484.
cite-note-1212. ↑ citerefkendlerkuhnvittumprescott2005Kendler KS, Kuhn JW, Vittum J, Prescott CA, Riley B (May 2005). "The interaction of stressful life events and a serotonin transporter polymorphism in the prediction of episodes of major depression: a replication". Archives of General Psychiatry. 62 (5): 529–35. doi:10.1001/archpsyc.62.5.529. PMID 15867106.
cite-note-1313. ↑ "Essential Science Indicators".
cite-note-1414. ↑ citerefculverhousesacconehortonma2017Culverhouse RC, Saccone NL, Horton AC, Ma Y, Anstey KJ, Banaschewski T, Burmeister M, Cohen-Woods S, Etain B (2017-04-04). "Collaborative meta-analysis finds no evidence of a strong interaction between stress and 5-HTTLPR genotype contributing to the development of depression". Molecular Psychiatry. 23 (1): 133–142. doi:10.1038/mp.2017.44. ISSN 1476-5578. PMC 5628077. PMID 28373689.
cite-note-1515. ↑ citerefrischherrelllehnerliang2009Risch N, Herrell R, Lehner T, Liang KY, Eaves L, Hoh J, Griem A, Kovacs M, Ott J, Merikangas KR (June 2009). "Interaction between the serotonin transporter gene (5-HTTLPR), stressful life events, and risk of depression: a meta-analysis". JAMA. 301 (23): 2462–71. doi:10.1001/jama.2009.878. PMC 2938776. PMID 19531786.
cite-note-1717. ↑ citerefkargburmeistersheddensen2011Karg K, Burmeister M, Shedden K, Sen S (May 2011). "The serotonin transporter promoter variant (5-HTTLPR), stress, and depression meta-analysis revisited: evidence of genetic moderation". Archives of General Psychiatry. 68 (5): 444–54. doi:10.1001/archgenpsychiatry.2010.189. PMC 3740203. PMID 21199959.
cite-note-1818. ↑ citerefduncankeller2011Duncan LE, Keller MC (October 2011). "A critical review of the first 10 years of candidate gene-by-environment interaction research in psychiatry". The American Journal of Psychiatry. 168 (10): 1041–9. doi:10.1176/appi.ajp.2011.11020191. PMC 3222234. PMID 21890791.
cite-note-1919. ↑ citerefdurhamwebbmilosclary2004Durham LK, Webb SM, Milos PM, Clary CM, Seymour AB (August 2004). "The serotonin transporter polymorphism, 5HTTLPR, is associated with a faster response time to sertraline in an elderly population with major depressive disorder". Psychopharmacology. 174 (4): 525–9. doi:10.1007/s00213-003-1562-3. PMID 12955294. S2CID 23798209.
cite-note-2020. ↑ citerefkraftslagermcgrathhamilton2005Kraft JB, Slager SL, McGrath PJ, Hamilton SP (September 2005). "Sequence analysis of the serotonin transporter and associations with antidepressant response". Biological Psychiatry. 58 (5): 374–81. doi:10.1016/j.biopsych.2005.04.048. PMID 15993855. S2CID 22673688.
cite-note-2121. ↑ citerefkraftpetersslagerjenkins2007Kraft JB, Peters EJ, Slager SL, Jenkins GD, Reinalda MS, McGrath PJ, Hamilton SP (March 2007). "Analysis of association between the serotonin transporter and antidepressant response in a large clinical sample". Biological Psychiatry. 61 (6): 734–42. doi:10.1016/j.biopsych.2006.07.017. PMID 17123473. S2CID 11331100.
cite-note-2222. ↑ citerefbocchio-chiavettominiussizanardinigazzoli2008Bocchio-Chiavetto L, Miniussi C, Zanardini R, Gazzoli A, Bignotti S, Specchia C, Gennarelli M (May 2008). "5-HTTLPR and BDNF Val66Met polymorphisms and response to rTMS treatment in drug resistant depression" (PDF). Neuroscience Letters. 437 (2): 130–4. doi:10.1016/j.neulet.2008.04.005. hdl:11572/145667. PMID 18450378. S2CID 36187651.
cite-note-1-2323. ↑ citerefhariridrabantmunozkolachana2005Hariri AR, Drabant EM, Munoz KE, Kolachana BS, Mattay VS, Egan MF, Weinberger DR (February 2005). "A susceptibility gene for affective disorders and the response of the human amygdala". Archives of General Psychiatry. 62 (2): 146–52. doi:10.1001/archpsyc.62.2.146. PMID 15699291.
cite-note-sens2004metaanalysis-2525. ↑ citerefsenburmeisterghosh2004Sen S, Burmeister M, Ghosh D (May 2004). "Meta-analysis of the association between a serotonin transporter promoter polymorphism (5-HTTLPR) and anxiety-related personality traits". American Journal of Medical Genetics. Part B, Neuropsychiatric Genetics. 127B (1): 85–9. doi:10.1002/ajmg.b.20158. hdl:2027.42/34671. PMID 15108187. S2CID 18798250.
cite-note-2626. ↑ citerefschinkabuschrobichaux-keene2004Schinka JA, Busch RM, Robichaux-Keene N (February 2004). "A meta-analysis of the association between the serotonin transporter gene polymorphism (5-HTTLPR) and trait anxiety". Molecular Psychiatry. 9 (2): 197–202. doi:10.1038/sj.mp.4001405. PMID 14966478. S2CID 21326834.
cite-note-2727. ↑ citerefleschbengelheilssabol1996Lesch KP, Bengel D, Heils A, Sabol SZ, Greenberg BD, Petri S, Benjamin J, Müller CR, Hamer DH, Murphy DL (November 1996). "Association of anxiety-related traits with a polymorphism in the serotonin transporter gene regulatory region". Science. 274 (5292): 1527–31. Bibcode:1996Sci...274.1527L. doi:10.1126/science.274.5292.1527. PMID 8929413. S2CID 35503987.
cite-note-2828. ↑ citerefgreenberglilucashu2000Greenberg BD, Li Q, Lucas FR, Hu S, Sirota LA, Benjamin J, Lesch KP, Hamer D, Murphy DL (April 2000). "Association between the serotonin transporter promoter polymorphism and personality traits in a primarily female population sample". American Journal of Medical Genetics. 96 (2): 202–16. doi:10.1002/(SICI)1096-8628(20000403)96:2<202::AID-AJMG16>3.0.CO;2-J. PMID 10893498.
cite-note-3030. ↑ citerefballhillfreemaneley1997Ball D, Hill L, Freeman B, Eley TC, Strelau J, Riemann R, Spinath FM, Angleitner A, Plomin R (March 1997). "The serotonin transporter gene and peer-rated neuroticism". NeuroReport. 8 (5): 1301–4. doi:10.1097/00001756-199703240-00048. PMID 9175133. S2CID 32097570.
cite-note-3232. ↑ citerefmunaf-freimerngophoff2009Munafò MR, Freimer NB, Ng W, Ophoff R, Veijola J, Miettunen J, Järvelin MR, Taanila A, Flint J (March 2009). "5-HTTLPR genotype and anxiety-related personality traits: a meta-analysis and new data". American Journal of Medical Genetics. Part B, Neuropsychiatric Genetics. 150B (2): 271–81. doi:10.1002/ajmg.b.30808. PMC 2819421. PMID 18546120.
cite-note-3333. ↑ citerefterraccianobalacithayerscally2009Terracciano A, Balaci L, Thayer J, Scally M, Kokinos S, Ferrucci L, Tanaka T, Zonderman AB, Sanna S, Olla N, Zuncheddu MA, Naitza S, Busonero F, Uda M, Schlessinger D, Abecasis GR, Costa PT (December 2009). "Variants of the serotonin transporter gene and NEO-PI-R Neuroticism: No association in the BLSA and SardiNIA samples". American Journal of Medical Genetics. Part B, Neuropsychiatric Genetics. 150B (8): 1070–7. doi:10.1002/ajmg.b.30932. PMC 2788669. PMID 19199283.
cite-note-3535. ↑ citerefbeeverswellsellismcgeary2009Beevers CG, Wells TT, Ellis AJ, McGeary JE (August 2009). "Association of the serotonin transporter gene promoter region (5-HTTLPR) polymorphism with biased attention for emotional stimuli". Journal of Abnormal Psychology. 118 (3): 670–81. doi:10.1037/a0016198. PMC 2841741. PMID 19685963.
cite-note-3636. ↑ citerefbeeverselliswellsmcgeary2010Beevers CG, Ellis AJ, Wells TT, McGeary JE (March 2010). "Serotonin transporter gene promoter region polymorphism and selective processing of emotional images". Biological Psychology. 83 (3): 260–5. doi:10.1016/j.biopsycho.2009.08.007. PMC 2834869. PMID 19715738.
cite-note-3737. ↑ citerefarbellebenjamingolinkremer2003Arbelle S, Benjamin J, Golin M, Kremer I, Belmaker RH, Ebstein RP (April 2003). "Relation of shyness in grade school children to the genotype for the long form of the serotonin transporter promoter region polymorphism". The American Journal of Psychiatry. 160 (4): 671–6. doi:10.1176/appi.ajp.160.4.671. PMID 12668354.
cite-note-3838. ↑ citerefvan-dyckmalisonstaleyjacobsen2004van Dyck CH, Malison RT, Staley JK, Jacobsen LK, Seibyl JP, Laruelle M, Baldwin RM, Innis RB, Gelernter J (March 2004). "Central serotonin transporter availability measured with [123I]beta-CIT SPECT in relation to serotonin transporter genotype". The American Journal of Psychiatry. 161 (3): 525–31. doi:10.1176/appi.ajp.161.3.525. PMID 14992979.
cite-note-3939. ↑ citerefparseyhastingsoquendohu2006Parsey RV, Hastings RS, Oquendo MA, Hu X, Goldman D, Huang YY, Simpson N, Arcement J, Huang Y, Ogden RT, Van Heertum RL, Arango V, Mann JJ (January 2006). "Effect of a triallelic functional polymorphism of the serotonin-transporter-linked promoter region on expression of serotonin transporter in the human brain". The American Journal of Psychiatry. 163 (1): 48–51. doi:10.1176/appi.ajp.163.1.48. PMID 16390888.
cite-note-4040. ↑ citerefreimoldsmolkaschumannzimmer2007Reimold M, Smolka MN, Schumann G, Zimmer A, Wrase J, Mann K, Hu XZ, Goldman D, Reischl G, Solbach C, Machulla HJ, Bares R, Heinz A (2007). "Midbrain serotonin transporter binding potential measured with [11C]DASB is affected by serotonin transporter genotype". Journal of Neural Transmission. 114 (5): 635–9. doi:10.1007/s00702-006-0609-0. PMID 17225932. S2CID 9369923.
cite-note-4141. ↑ citerefpezawasmeyer-lindenbergdrabantverchinski2005Pezawas L, Meyer-Lindenberg A, Drabant EM, Verchinski BA, Munoz KE, Kolachana BS, Egan MF, Mattay VS, Hariri AR, Weinberger DR (June 2005). "5-HTTLPR polymorphism impacts human cingulate-amygdala interactions: a genetic susceptibility mechanism for depression". Nature Neuroscience. 8 (6): 828–34. doi:10.1038/nn1463. PMID 15880108. S2CID 1864631.
cite-note-4242. ↑ citereffurmarktillforsgarpenstrandmarteinsdottir2004Furmark T, Tillfors M, Garpenstrand H, Marteinsdottir I, Långström B, Oreland L, Fredrikson M (May 2004). "Serotonin transporter polymorphism related to amygdala excitability and symptom severity in patients with social phobia". Neuroscience Letters. 362 (3): 189–92. doi:10.1016/j.neulet.2004.02.070. PMID 15158011. S2CID 5638054.
cite-note-4343. ↑ citerefgraff-guerrerode-la-fuente-sandovalcamarenag-mez-martin2005Graff-Guerrero A, De la Fuente-Sandoval C, Camarena B, Gómez-Martin D, Apiquián R, Fresán A, Aguilar A, Méndez-Núñez JC, Escalona-Huerta C, Drucker-Colín R, Nicolini H (May 2005). "Frontal and limbic metabolic differences in subjects selected according to genetic variation of the SLC6A4 gene polymorphism". NeuroImage. 25 (4): 1197–204. doi:10.1016/j.neuroimage.2004.12.020. PMID 15850737. S2CID 20402303.
cite-note-4444. ↑ citerefharirimattaytessitorekolachana2002Hariri AR, Mattay VS, Tessitore A, Kolachana B, Fera F, Goldman D, Egan MF, Weinberger DR (July 2002). "Serotonin transporter genetic variation and the response of the human amygdala". Science. 297 (5580): 400–3. Bibcode:2002Sci...297..400H. doi:10.1126/science.1071829. PMID 12130784. S2CID 29315003. Comment: citerefmiller2002Miller G (July 2002). "Neuroscience. Gene's effect seen in brain's fear response". Science. 297 (5580): 319a–319. doi:10.1126/science.297.5580.319a. PMID 12130759. S2CID 28337659.
cite-note-4545. ↑ citerefdannlowskiohrmannbauerdeckert2008Dannlowski U, Ohrmann P, Bauer J, Deckert J, Hohoff C, Kugel H, Arolt V, Heindel W, Kersting A, Baune BT, Suslow T (January 2008). "5-HTTLPR biases amygdala activity in response to masked facial expressions in major depression". Neuropsychopharmacology. 33 (2): 418–24. doi:10.1038/sj.npp.1301411. PMID 17406646.
cite-note-4646. ↑ citerefheitlandkenemansoostingbaas2013Heitland I, Kenemans JL, Oosting RS, Baas JM, Böcker KB (July 2013). "Auditory event-related potentials (P3a, P3b) and genetic variants within the dopamine and serotonin system in healthy females". Behavioural Brain Research. 249: 55–64. doi:10.1016/j.bbr.2013.04.013. PMID 23619133. S2CID 22589525.
cite-note-berb-4747. ↑ • citerefyujingongwang2013Yu H, Jin H, Gong W, Wang Z, Liang H (2013). "Pharmacological Actions of Multi-Target-Directed Evodiamine". Molecules. 18 (2). MDPI AG: 1826–1843. doi:10.3390/molecules18021826. ISSN 1420-3049. PMC 6270287. PMID 23434865. • citerefahmedgilaniabdollahidaglia2015Ahmed T, Gilani A, Abdollahi M, Daglia M, Nabavi S, Nabavi M (2015). "Berberine and neurodegeneration: A review of literature". Pharmacological Reports. 67 (5). Institute of Pharmacology, Polish Academy of Sciences (Elsevier Sp. z o.o.): 970–979. doi:10.1016/j.pharep.2015.03.002. ISSN 1734-1140. PMID 26398393. S2CID 751303. • citerefhuehlihudziakdavies2011Hu Y, Ehli EA, Hudziak JJ, Davies GE (2011). "Berberine and evodiamine influence serotonin transporter (5-HTT) expression via the 5-HTT-linked polymorphic region". The Pharmacogenomics Journal. 12 (5). Macmillan Publishers Limited: 372–378. doi:10.1038/tpj.2011.24. ISSN 1470-269X. PMID 21647174. S2CID 11148104.
Further reading
• "Serotonin Transporter-Linked Polymorphic Region (5HTTLPR) and rs25531 SNP (Mspl, LA/LG)". Archived from the original on 2017-04-07. Retrieved 2015-05-04.
External links